Search Results Page | Fisher Scientific

Bio-Techne (205)
Novus Biologicals (57,362)
R&D Systems (34)

spezialprogramme

Greener Choice (14)

Protein State

Denatured (2)
Native (14,849)

Rekombinant

Native (1)
Recombinant (2,340)

Wirtsspezies

Canine (2)
Chicken (2)
Goat (4)
Human (499)
Mouse (235)
Non-species Specific (1)
Primate (5)
Rabbit (295)
Rat (23)

Form

Ascites (2)
Liquid (3)
Lyophilized (2)
Purified (652)

1 – 15 von 49,846 Ergebnisse

Novus Biologicals™ Flagellin Native Protein

Native Protein

Preisgestaltung & Verfügbarkeit

Rekombinante Proteine

Novus Biologicals™ Recombinant Protein A Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit
Technische Daten

Rekombinante Proteine

Zusammensetzung	Lyophilized from additive free solution.
Lagerungsbedingungen	Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles.
Forschungskategorie	Epitope Tags
Molekulargewicht	33.4 kDa
Rekonstitution	Dissolve in distilled water or saline.
Zur Verwendung mit (Anwendung)	PAGE,Bioactivity,HPLC
Konzentration	LYOPH
Endotoxin-Konzentration	Less than 0.1 EU/ug of Protein A as determined by LAL method.
Gen-Alias	Immunoglobulin G binding protein A, SPA, Staphylococcal protein A
Protein	Protein A
Reinheits- oder Qualitätsgrad	>97% pure by SDS-PAGE and HPLC
Gen-ID (Entrez)	3919448

Novus Biologicals™ Human Heart Whole Tissue Lysate (Adult Whole Normal)

Preisgestaltung & Verfügbarkeit

Gewebelysate

R&D Systems™ Human Thrombospondin-1 Quantikine ELISA Kit

Human Thrombospondin-1 Quantikine ELISA Kit from the most referenced ELISA manufacturer. Highly validated for accurate quantitation and long-term reproducibility.

Preisgestaltung & Verfügbarkeit

ELISA-Kits zur Life-Science-Forschung

Novus Biologicals Recombinant Human alpha-Synuclein Active, Pre-formed Fibrils, (Type 1), A53T Mutant Protein

Preisgestaltung & Verfügbarkeit
Technische Daten

Rekombinante Proteine

Gensymbol	SNCA
Zusammensetzung	PBS pH 7.4
Lagerungsbedingungen	Store at -80C. Avoid freeze-thaw cycles.
Forschungskategorie	Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience
Zur Verwendung mit (Anwendung)	Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
Gen-Alias	alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein
Protein	alpha-Synuclein
Reinheits- oder Qualitätsgrad	>95%, by SDS-PAGE
Gen-ID (Entrez)	6622

Novus Biologicals™ Recombinant Human XRCC1 GST (N-Term) Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit
Technische Daten

Rekombinante Proteine

Gensymbol	XRCC1
Zusammensetzung	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Lagerungsbedingungen	Store at -80°C. Avoid freeze-thaw cycles.
Forschungskategorie	Apoptosis, Base Excision Repair, Cancer, DNA Repair, Homologous Recombination, Tumor Suppressors
Molekulargewicht	MolecularWeight-theroretical: 95.26 kDa
Zur Verwendung mit (Anwendung)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Gen-Alias	DNA repair protein XRCC1, RCC, X-ray repair complementing defective repair in Chinese hamster cells 1, X-ray repair cross-complementing protein 1, X-ray-repair, complementing defective, repair in Chinese hamster
Protein	XRCC1
Reinheits- oder Qualitätsgrad	>80% by SDS-PAGE and Coomassie blue staining
Gen-ID (Entrez)	7515

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Highly purified and high bioactivity. Generating reliable and reproducible results.

Preisgestaltung & Verfügbarkeit
Technische Daten

Rekombinante Proteine

Kennzeichnung	RUO
Rekombinant	Recombinant
Konjugat	Unconjugated
Name	Human alpha-Synuclein Aggregate Protein
Gensymbol	SNCA
Zusammensetzung	PBS
Kreuzreaktivität	Human
Immunogen	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Zur Verwendung mit (Anwendung)	In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
Reinigungsverfahren	>95% pure by SDS-PAGE
Produkttyp	Recombinant Protein
Gen-Alias	alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Quelle	E.Coli
Gen-ID (Entrez)	6622

Novus Biologicals™ Recombinant Human UBE2R1/CDC34 Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit
Technische Daten

Rekombinante Proteine

Gensymbol	CDC34
Zusammensetzung	A 0.2 μm filtered concentrated solution in 50 mM HEPES, pH 7.0, 125 mM NaCl, 10 % Glycerol, 1 mM DTT.
Lagerungsbedingungen	Store at -20°C. Avoid freeze/thaw cycles.
Forschungskategorie	Cancer, Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
Molekulargewicht	MolecularWeight-theroretical: 26.7 kDa
Zur Verwendung mit (Anwendung)	SDS-PAGE
Endotoxin-Konzentration	Less than 0.1 EU/μg of UBE2R1/CDC34 as determined by LAL method.
Gen-Alias	cell division cycle 34, cell division cycle 34 homolog (S. cerevisiae), E2-CDC34, EC 6.3.2.19, UBC3, UBE2R1UBCH3, ubiquitin carrier protein, ubiquitin-conjugating enzyme E2 R1, Ubiquitin-conjugating enzyme E2-32 kDa complementing, Ubiquitin-conjugating enzyme E2-CDC34, Ubiquitin-protein ligase R1
Protein	UBE2R1/CDC34
Reinheits- oder Qualitätsgrad	>95%, by SDS-PAGE and HPLC
Gen-ID (Entrez)	997

Novus Biologicals™ Recombinant Mouse LIGHT/TNFSF14 Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit
Technische Daten

Rekombinante Proteine

Gensymbol	TNFSF14
Zusammensetzung	Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.4.
Lagerungsbedingungen	Store at -20°C to -70°C as supplied. After reconstitution, store at 2 to 8 C for 1 month and (at -20°C to -70°C for long term storage. Avoid repeated freeze/thaw cycles.)
Forschungskategorie	Apoptosis
Molekulargewicht	MolecularWeight-theroretical: 18.4 kDa
Rekonstitution	Recommended to centrifuge prior to opening. Reconstitute in 100 mM HAC to a concentration of 0.1-1.0 mg/mL Apportion stock solutions into working aliquots and store (at <-20°C.)
Zur Verwendung mit (Anwendung)	Western Blot,Bioactivity
Endotoxin-Konzentration	Less than 1 EU/μg of LIGHT/TNFSF14 as determined by LAL method.
Gen-Alias	CD258, CD258 antigen, delta transmembrane LIGHT, Herpes virus entry mediator ligand, Herpesvirus entry mediator ligand, HVEM-L, HVEMLherpesvirus entry mediator-ligand, ligand for herpesvirus entry mediator, LIGHTherpesvirus entry mediator A, LTg, TR2, tumor necrosis factor (ligand) superfamily, member 14, tumor necrosis factor ligand superfamily member 14, tumor necrosis factor receptor-like 2, tumor necrosis factor superfamily member LIGHT
Protein	LIGHT/TNFSF14
Reinheits- oder Qualitätsgrad	>95%, by SDS-PAGE and HPLC
Gen-ID (Entrez)	8740

Novus Biologicals™ Recombinant Human IFN-gamma Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit
Technische Daten

Rekombinante Proteine

Lagerungsbedingungen	Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles.
Forschungskategorie	Biologically Active Proteins, Cytokine Research, Immunology, Innate Immunity, Stem Cell Markers
Rekonstitution	Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C.
Konzentration	LYOPH
Zugriffsnummer	P01579
Protein	IFN-gamma
Reinheits- oder Qualitätsgrad	>98% pure by SDS-PAGE and HPLC
Gensymbol	IFNG
Zusammensetzung	Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4.
Molekulargewicht	16.9 kDa
Zur Verwendung mit (Anwendung)	PAGE,Bioactivity
Endotoxin-Konzentration	Less than 1 EU/ug of IFN-gamma as determined by LAL method.
Gen-Alias	IFG, IFI, IFN-gamma, Immune interferon, interferon gamma, interferon, gamma
Gen-ID (Entrez)	3458

Novus Biologicals™ Recombinant Protein G Cys (N-Term) Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit

Rekombinante Proteine

Novus Biologicals™ Recombinant Protein A Cys (C-Term) Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit
Technische Daten

Rekombinante Proteine

Zusammensetzung	Lyophilized from additive free solution.
Lagerungsbedingungen	Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles.
Forschungskategorie	Biologically Active Proteins, Epitope Tags
Molekulargewicht	33.5 kDa
Rekonstitution	Reconstitute with distilled water or saline.
Zur Verwendung mit (Anwendung)	PAGE,Bioactivity
Konzentration	LYOPH
Endotoxin-Konzentration	Less than 0.1 EU/ug of Protein A as determined by LAL method.
Gen-Alias	Immunoglobulin G binding protein A, SPA, Staphylococcal protein A
Protein	Protein A
Reinheits- oder Qualitätsgrad	>98% pure by SDS-PAGE and HPLC
Gen-ID (Entrez)	3919448

Novus Biologicals™ Mouse Brain Whole Tissue Lysate (Adult Whole Normal)

Preisgestaltung & Verfügbarkeit

Gewebelysate

Novus Biologicals™ Recombinant Bacteria Listeria monocytogenes p60 His Protein

Recombinant Protein

Preisgestaltung & Verfügbarkeit
Technische Daten

Rekombinante Proteine

Zusammensetzung	Liquid. 0.2um-filtered solution in PBS, pH 7.2
Lagerungsbedingungen	Store at 4C short term. Aliquot and Store at -20°C long term. Avoid freeze-thaw cycles.
Forschungskategorie	Immunology
Molekulargewicht	M.W. Theoretical: 50 kDa
Zur Verwendung mit (Anwendung)	SDS-PAGE
Konzentration	0.5 mg/ml
Zugriffsnummer	P21171
Endotoxin-Konzentration	<1 EU/μg purified protein (LAL test; Lonza).
Gen-Alias	IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein
Protein	Listeria monocytogenes p60
Reinheits- oder Qualitätsgrad	>90% SDS-PAGE

Novus Biologicals™ WDR5 Protein

Highly purified. Generating reliable and reproducible results.

Preisgestaltung & Verfügbarkeit
Technische Daten

Rekombinante Proteine

Zusammensetzung	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl.
Kennzeichnung	RUO
Lagerungsbedingungen	Store at -80°C. Avoid freeze-thaw cycles.
Gebräuchliche Bezeichnung	WDR5
Molekulargewicht	38.8kDa
Konjugat	Unconjugated
Zur Verwendung mit (Anwendung)	SDS-PAGE
Konzentration	1mg/mL
Reinigungsverfahren	SDS-PAGE
Reinheits- oder Qualitätsgrad	>95%

Vorherige
1
2
3
4
5
6
...
3,324
Nächste

Gefilterte Suchergebnisse

Ergebnisse verfeinern