missing translation for 'onlineSavingsMsg'
Learn More
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active) Artikelnummer.: 18735843
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Artikelnummer. 18735843 Alle ansehen Bio Techne Produkte
100 μg, 1 Set
Click to view available options
Menge:
100 μg
200 μg
500 μg
Packungsgröße:
1 Set
200 Mikrogramm
500 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18735843

Marke: Novus Biologicals™ NBP254789100UG

om dit product te kopen Registreer vandaag om een webaccount aan te maken

617.10 CHF gültig bis 2025-12-16
Benutzen Sie den Promotions-Code "24090" um Ihren Promotions-Preis zu erhalten.
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Highly purified and high bioactivity. Generating reliable and reproducible results.

An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.
TRUSTED_SUSTAINABILITY

Spezifikation

Zur Verwendung mit (Anwendung) In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot
Zusammensetzung PBS
Gen-ID (Entrez) 6622
Name Human alpha-Synuclein Aggregate Protein
Reinigungsverfahren >95% pure by SDS-PAGE
Menge 100 μg
Quelle E.Coli
Immunogen MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Lagerungsbedingungen Store at −80°C. Avoid freeze-thaw cycles.
Kennzeichnung RUO
Gen-Alias alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Gensymbol SNCA
Biologische Aktivität Endogenous alpha-synuclein phosphorylation. 100μM alpha synuclein protein monomer seeded with 10nM alpha synuclein protein aggregate in 25μM Thioflavin T (PBS pH 7.4, 100μL reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450nm and emission at 485nm on a Molecular Devices Gemini XPS microplate reader.
Produkttyp Recombinant Protein
Konjugat Unconjugated
Kreuzreaktivität Human
Rekombinant Recombinant
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active) >

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt