Alle Primärantikörper
Primärantikörper – Immunglobuline, die an bestimmte Proteine oder andere Biomoleküle binden – werden bei vielen Forschungsanwendungen und Protokollen zum Nachweis von Zielen verwendet. Sie werden unter Verwendung verschiedener Wirtstiere entwickelt, darunter Mäuse, Ratten, Kaninchen, Ziegen, Schafe und viele andere.
Monoklonale und polyklonale Antikörper
Eine Art von Primärantikörpern, die so genannten monoklonale Antikörper, bietet eine hohe Reproduzierbarkeit sowie geringe Kreuzreaktivität und geringes Hintergrundrauschen. Ein anderer Typ, die so genannten polyklonalen Antikörper, kostet oft weniger und bietet eine höhere Affinität und schnellere Bindung. Beide werden unter Verwendung von Plasma-B-Zellen hergestellt, erstere verwenden jedoch denselben Klon und letztere verwenden unterschiedliche Klone. Monoklonale Antikörper erfordern Hybridomzelllinien, polyklonale Antikörper hingegen nicht.
Es gibt auch rekombinante monoklonale Antikörper mit ähnlichen Vorteilen, wie hoher Affinität, Skalierbarkeit und Spezifität. Sie werden mithilfe von In-vitro-Klonierung von Plasma-B-Zellen und Expressionswirten hergestellt.
Konjugierte Primärantikörper
Antikörper können mit verschiedenen Fluorophoren oder Detektionsmitteln markiert oder ohne Markierungen verwendet werden. Markierte Primärantikörper, auch konjugierte Primärantikörper genannt, helfen Forschern, ihre Anwendungen zu vereinfachen und zu optimieren. Sie werden mit gängigen Enzymen und Farbstoffen wie Alexa Fluor gekoppelt und häufig bei der Protein- und Zellanalyse verwendet.
Anwendungen
Antikörper für Life-Science-Anwendungen werden bei der Durchflusszytometrie, Western Blotting, ELISA, Immunhistochemie und Immunozytochemie eingesetzt. Sekundärantikörper können hinzugefügt werden, um den Nachweis und die Aufreinigung bestimmter Antigene zu unterstützen. Sie binden an den primären Antikörper, der an das Antigen von Interesse bindet. Das Auffinden der richtigen Kombination von Antikörpern kann zu einer größeren Antigenspezifität und einem starken, nachweisbaren Signal führen.
- (23)
- (12)
- (28)
- (116)
- (16)
- (193)
- (84)
- (123)
- (9)
- (6,016)
- (15)
- (31)
- (46)
- (221)
- (23,604)
- (562)
- (559)
- (562)
- (19)
- (1)
- (26,663)
- (98)
- (1,061)
- (1,758)
- (1)
- (28)
- (892)
- (10)
- (6)
- (36)
- (416)
- (271)
- (11,175)
- (6,712)
- (14)
- (16,486)
- (35,404)
- (162)
- (3,955)
- (8)
- (35,542)
- (24)
- (35)
- (5,327)
- (26)
- (24)
- (9)
- (107)
- (4)
- (10)
- (1)
- (835)
- (1)
- (5)
- (11)
- (8)
- (13)
- (727)
- (1)
- (2)
- (136)
- (13)
- (1,114)
- (31)
- (99)
- (111)
- (361)
- (28)
- (11)
- (762)
- (51)
- (25)
- (9)
- (5)
- (51,904)
- (78)
- (61,132)
- (26,711)
- (2,200)
- (370)
- (3)
- (22)
- (1)
- (1,997)
- (2,201)
- (2,235)
- (2,163)
- (14)
- (1,984)
- (2,284)
- (2,193)
- (2,004)
- (2,733)
- (72)
- (34)
- (8)
- (1)
- (1)
- (8)
- (9)
- (100)
- (7)
- (1)
- (2)
- (1)
- (4)
- (5)
- (3,105)
- (1)
- (2,710)
- (2,714)
- (2,671)
- (2,678)
- (3,004)
- (2,691)
- (2,742)
- (2,741)
- (2,705)
- (2,689)
- (1,536)
- (2,808)
- (723)
- (723)
- (2,827)
- (1,511)
- (2,300)
- (7)
- (4)
- (365)
- (375)
- (368)
- (5)
- (2,374)
- (8)
- (1)
- (1)
- (12,142)
- (3)
- (2,242)
- (2,206)
- (2,202)
- (1)
- (714)
- (172)
- (257)
- (219)
- (38)
- (209)
- (70,587)
- (1,375)
- (168)
- (5)
- (602)
- (105)
- (220)
- (20)
- (628)
- (29)
- (32)
- (146)
- (1)
- (1)
- (967)
- (7,033)
- (165)
- (3)
- (371)
- (1)
- (121)
- (743)
- (13)
- (8)
- (19)
- (2)
- (406)
- (264)
- (125)
- (3)
- (3)
- (1)
- (6)
- (8)
- (15)
- (165)
- (1,444)
- (215)
- (2)
- (19)
- (15)
- (173)
- (102)
- (130)
- (1,483)
- (60)
- (1,890)
- (44,267)
- (34,865)
- (3,646)
- (1,385)
Gefilterte Suchergebnisse
Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
| Testspezifität | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
|---|---|
| Gen-Zugriffsnummer | P23946 |
| Konjugat | Unconjugated |
| Isotype | IgG |
| Gensymbole | CMA1 |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Klassifikation | Polyclonal |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Regulatorischer Status | RUO |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS |
| Zielspezies | Human |
| Forschungsgebiet | Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Anwendungen | Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Verdünnung | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Gen-Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gen-ID (Entrez) | 1215 |
Chymase/CMA1/Mast Cell Chymase Antibody (CC1), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 2 publications
| Testspezifität | This reacts with mast cells distributed in skin, synovium, lung and heart. |
|---|---|
| Klon | CC1 |
| Form | Purified |
| Gen-Zugriffsnummer | P23946 |
| Konjugat | Unconjugated |
| Isotype | IgG1 |
| Gensymbole | CMA1 |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4C. Do not freeze. |
| Klassifikation | Monoclonal |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Regulatorischer Status | RUO |
| Immunogen | BALB/C mice were injected with a purified human skin chymase. |
| Zielspezies | Human |
| Forschungsgebiet | Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein A or G purified |
| Gen-Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gen-ID (Entrez) | 1215 |
Epredia™ Lab Vision™ Desmin (Muscle Cell Marker) Ab-1, Mouse Monoclonal Antibody
Specifically detect desmin in human, baboon, monkey, cow, cat, dog, hamster, rat and chicken samples.
| Klassifikation | Monoclonal |
|---|---|
| Antigen | Desmin (Muscle Cell Marker) Ab-1 |
| Regulatorischer Status | IVD |
| Klon | D33 |
| Immunogen | Desmin from human muscle |
| Forschungsgebiet | Muscle Biology |
| Wirtsspezies | Mouse |
| Konjugat | Unconjugated |
| Anwendungen | Immunofluorescence,Immunohistochemistry (Paraffin) |
| Primär oder sekundär | Primary |
CD31/PECAM-1 (Endothelial Cell Marker) Rabbit Polyclonal Antibody, Epredia™
Ensure accurate, reproducible results in immunohistochemistry procedures with Epredia™ CD31/PECAM-1 (Endothelial Cell Marker), Rabbit Polyclonal Antibody.
| Klassifikation | Polyclonal |
|---|---|
| Antigen | CD31 (Endothelial Cell Marker) |
| Regulatorischer Status | RUO |
| Immunogen | Synthetic peptide corresponding to C-terminus of mouse CD31 protein |
| Zielspezies | Human |
| Forschungsgebiet | Cancer and Tumor Biology |
| Wirtsspezies | Rabbit |
| Konjugat | Unconjugated |
| Reinigungsverfahren | Tonsil |
| Anwendungen | Immunohistochemistry (Paraffin) |
| Primär oder sekundär | Primary |
| Klon | MCG35 |
|---|---|
| Form | Purified |
| Konjugat | Unconjugated |
| Isotype | IgG1 κ |
| Konzentration | 1 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS |
| Klassifikation | Monoclonal |
| Antigen | Mast Cell Marker |
| Regulatorischer Status | RUO |
| Immunogen | Spleen cells and bone marrow cells (erythrocyte depleted) from a patient with systemic mastocytosis. The bone marrow preparation consisted of 50% typical mast cells. |
| Zielspezies | Human |
| Forschungsgebiet | Cardiovascular Biology |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein A purified |
| Anwendungen | Immunohistochemistry |
| Verdünnung | Immunohistochemistry 1:10 - 1:500 |
L1 Cell Adhesion Molecule Ab-1 Mouse Monoclonal Antibody, Epredia™
Recommended for Immunohistochemistry (Formalin/paraffin), Western Blotting and Immunoprecipitation (Native and denatured), Epredia™ L1 Cell Adhesion Molecule Ab-1, Mouse Monoclonal Antibody provides accurate, reproducible results.
| Klassifikation | Monoclonal |
|---|---|
| Antigen | L1 Cell Adhesion Molecule Ab-1 |
| Regulatorischer Status | RUO |
| Klon | UJ127 |
| Immunogen | Homogenous suspension of 16 week human fetal brain |
| Zielspezies | Human |
| Forschungsgebiet | Cancer and Tumor Biology |
| Wirtsspezies | Mouse |
| Isotype | IgG2a κ |
| Anwendungen | Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot |
| Primär oder sekundär | Primary |
Epredia™ Lab Vision™ CD3 (Early T-Cell Marker) Rabbit Monoclonal Antibody,
Stain normal and neoplastic T cells in formalin-fixed, paraffin-embedded tissues with Epredia™ CD3 (Early T-Cell Marker), Rabbit Monoclonal Antibody.
| Klassifikation | Monoclonal |
|---|---|
| Antigen | CD3 |
| Regulatorischer Status | IVD |
| Klon | SP7 |
| Immunogen | A synthetic 13-mer peptide corresponding to aa 156-168 of the epsilon-chain of human CD3 protein |
| Forschungsgebiet | Cancer and Tumor Biology |
| Wirtsspezies | Rabbit |
| Konjugat | Unconjugated |
| Anwendungen | Immunohistochemistry (Paraffin) |
| Primär oder sekundär | Primary |
Panendothelial Cell Antigen Antibody (MECA-32), Alexa Fluor™ 488, Novus Biologicals™
Rat Monoclonal Antibody
| Klon | MECA-32 |
|---|---|
| Form | Purified |
| Konjugat | Alexa Fluor 488 |
| Isotype | IgG2a κ |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C in the dark. |
| Zusammensetzung | 50mM Sodium Borate |
| Klassifikation | Monoclonal |
| Antigen | Panendothelial Cell Antigen |
| Regulatorischer Status | RUO |
| Immunogen | Mouse lymph node stromal cells. |
| Zielspezies | Human,Mouse |
| Forschungsgebiet | Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Extracellular Matrix, Hypoxia, Immunology, Mesenchymal Stem Cell Markers, Stem Cell Markers |
| Wirtsspezies | Rat |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry/Immunofluorescence,Immunoprecipitation |
| Gen-Alias | FELS, Fenestrated endothelial-linked structure protein, gp68, MECA32, MECA-32, Panendothelial Cell Antigen, plasmalemma vesicle associated protein, Plasmalemma Vesicle Protein 1, PV-1 protein |
| Gen-ID (Entrez) | 84094 |
Epredia™ Lab Vision™ CD79a/mb-1 (B-Cell Marker), Rabbit Monoclonal Antibody
Obtain accurate, reproducible results in immunohistochemistry experiments with Epredia™ CD79a/mb-1 (B-Cell Marker), Rabbit Monoclonal Antibody.
| Klassifikation | Monoclonal |
|---|---|
| Antigen | CD79a/mb-1 (B-Cell Marker) |
| Regulatorischer Status | IVD |
| Klon | SP18 |
| Immunogen | Synthetic peptide derived from N-terminal region of human CD79a protein |
| Forschungsgebiet | Cancer and Tumor Biology |
| Wirtsspezies | Rabbit |
| Konjugat | Unconjugated |
| Anwendungen | Immunohistochemistry (Paraffin) |
| Primär oder sekundär | Primary |
Renal Cell Carcinoma Marker (gp200) Ab-1 Mouse Monoclonal Antibody, Epredia™
Provide accurate, reproducible results with the Epredia™ Renal Cell Carcinoma Marker (gp200) Ab-1, Mouse Monoclonal Antibody.
| Klassifikation | Monoclonal |
|---|---|
| Antigen | Renal Cell Carcinoma Marker (gp200) Ab-1 |
| Regulatorischer Status | IVD |
| Klon | PN-15 |
| Immunogen | Microsomal fraction of human renal cortical tissue homogenate |
| Forschungsgebiet | Cancer and Tumor Biology |
| Wirtsspezies | Mouse |
| Anwendungen | Immunohistochemistry (Paraffin),Western Blot |
| Primär oder sekundär | Primary |
Chymase/CMA1/Mast Cell Chymase Rabbit anti-Human, Mouse, Rat, Clone: 2O4P8, Novus Biologicals™
Rabbit Monoclonal Antibody
| Klon | 2O4P8 |
|---|---|
| Form | Purified |
| Konjugat | Unconjugated |
| Isotype | IgG |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at -20°C. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Klassifikation | Monoclonal |
| Antigen | Chymase/CMA1/Mast Cell Chymase |
| Regulatorischer Status | RUO |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Chymase/CMA1/Mast Cell Chymase (CMA1) (P23946). GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN |
| Zielspezies | Human,Mouse,Rat |
| Forschungsgebiet | Cell Biology, Cellular Markers, Immunology, Innate Immunity, Mast Cell Markers |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity purified |
| Anwendungen | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Verdünnung | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Gen-Alias | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
| Gen-ID (Entrez) | 1215 |
Zebrafish Gut Secretory Cell Epitopes Antibody (FIS 6G5/1) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
| Klon | FIS 6G5/1 |
|---|---|
| Form | Purified |
| Konjugat | Unconjugated |
| Isotype | IgG1 |
| Konzentration | 0.9 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS |
| Klassifikation | Monoclonal |
| Antigen | Zebrafish Gut Secretory Cell Epitopes |
| Regulatorischer Status | RUO |
| Immunogen | Lysate of zebrafish intestine |
| Zielspezies | Zebrafish |
| Forschungsgebiet | Cell Cycle and Replication, Cellular Signaling, Developmental Biology, Epigenetics, Epitope Tags |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein A purified |
| Anwendungen | Western Blot,ELISA,Immunohistochemistry,Immunofluorescence |
| Verdünnung | Western Blot 1:200, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/ Immunofluorescence 1:10 - 1:500 |
Zebrafish Gut Absorptive Cell Epitopes Antibody (FIS 4E8/1) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
| Klon | FIS 4E8/1 |
|---|---|
| Form | Purified |
| Konjugat | Unconjugated |
| Isotype | IgG1 |
| Konzentration | 1 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS |
| Klassifikation | Monoclonal |
| Antigen | Zebrafish Gut Absorptive Cell Epitopes |
| Regulatorischer Status | RUO |
| Immunogen | Lysate of zebrafish intestines |
| Zielspezies | Zebrafish |
| Forschungsgebiet | Cell Cycle and Replication, Cellular Signaling, Developmental Biology, Epigenetics, Epitope Tags |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein A purified |
| Anwendungen | Western Blot,Immunohistochemistry,Immunoprecipitation |
| Verdünnung | Western Blot 1:200, Immunohistochemistry 1:10 - 1:500, Immunoprecipitation 1:10 - 1:500 |
Zebrafish Gut Secretory Cell Epitopes Antibody (FIS 4B7/2) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
| Klon | FIS 4B7/2 |
|---|---|
| Form | Purified |
| Konjugat | Unconjugated |
| Isotype | IgG1 |
| Konzentration | 1 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS |
| Klassifikation | Monoclonal |
| Antigen | Zebrafish Gut Secretory Cell Epitopes |
| Regulatorischer Status | RUO |
| Immunogen | Lysate of fish intestine |
| Zielspezies | Zebrafish |
| Forschungsgebiet | Cell Cycle and Replication, Cellular Signaling, Developmental Biology, Epigenetics, Epitope Tags |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein A purified |
| Anwendungen | Western Blot,Immunohistochemistry,Immunofluorescence |
| Verdünnung | Western Blot 1:200, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/ Immunofluorescence 1:10 - 1:500 |