missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Marke: Novus Biologicals NBP2-33660-25ul
345.95 CHF gültig bis 2025-12-16
BESTER Aktionspreis! Benutzen Sie den Promotions-Code "24090" um Ihren Promotions-Preis zu erhalten.
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Chymase/CMA1/Mast Cell Chymase Polyclonal specifically detects Chymase/CMA1/Mast Cell Chymase in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spezifikation
| Chymase/CMA1/Mast Cell Chymase | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| P23946 | |
| CMA1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS | |
| 25 μL | |
| Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers | |
| 1215 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur