accessibility menu, dialog, popup

UserName

Antikörper

Antikörper sind Glykoproteine, die eine wesentliche Rolle im Immunsystem spielen. Sie schützen Tiere vor Infektionen oder zytotoxischen Auswirkungen fremder Verbindungen, indem sie mit hoher Affinität an invasive Moleküle binden, eingestuft als primär oder sekundär.
Primärantikörper (87,976)
Sekundärantikörper (22)
Isotypkontrollen und Isotypstandards (8)
Antikörper-Panels und Kits (1)

Gefilterte Suchergebnisse

Produkte von einigen unserer Lieferanten werden in den gefilterten Suchergebnissen nicht angezeigt. Bitte deaktivieren Sie alle Filter, um diese Produkte zu sehen.

Ergebnisse verfeinern

Ausgewählte Filter

Alle entfernen

Keyword Search

cell biology

Ergebnisse verfeinern

Ergebnisse verfeinern

In dieser Kategorie wurden keine Ergebnisse gefunden. Entfernen Sie einige der ausgewählten Filter und versuchen Sie es erneut.

kategorie

spezialangebot

  • (1,174)

marken

  • (153)
  • (1,846)
  • (567)
  • (42)
  • (2)
  • (81,872)
  • (3,513)
  • (12)

spezialprogramme

  • (1)
  • (11)

Anwendungen

  • (23)
  • (12)
  • (28)
  • (116)
  • (16)
  • (193)
  • (84)
Alle anzeigen

Klassifikation

  • (61,164)
  • (9)
  • (26,713)

Konjugat

  • (2,200)
  • (370)
  • (3)
  • (23)
  • (1)
  • (1,998)
  • (2,202)
Alle anzeigen

Menge

  • (1)
  • (714)
  • (172)
  • (257)
  • (219)
  • (38)
  • (209)
Alle anzeigen

Wirtsspezies

  • (102)
  • (130)
  • (1,483)
  • (61)
  • (1,890)
  • (44,302)
  • (34,875)
Alle anzeigen

Zielspezies

  • (15)
  • (43)
  • (76)
  • (3)
  • (169)
  • (16)
  • (190)
Alle anzeigen

Isotype

  • (2)
  • (1)
  • (4)
  • (4)
  • (2)
  • (11)
  • (3)
Alle anzeigen

Regulatorischer Status

  • (27)
  • (84,059)

Form

  • (42)
  • (79)
  • (28)
  • (459)
  • (59)
  • (15)
  • (9)
Alle anzeigen
1 – 15 von 84,023 Ergebnisse
1

Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Gen-Zugriffsnummer P23946
Konjugat Unconjugated
Isotype IgG
Gensymbole CMA1
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Klassifikation Polyclonal
Antigen Chymase/CMA1/Mast Cell Chymase
Regulatorischer Status RUO
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS
Zielspezies Human
Forschungsgebiet Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers
Wirtsspezies Rabbit
Reinigungsverfahren Affinity Purified
Anwendungen Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Verdünnung Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gen-Alias Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891
Gen-ID (Entrez) 1215
3

Chymase/CMA1/Mast Cell Chymase Antibody (CC1), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 2 publications

Testspezifität This reacts with mast cells distributed in skin, synovium, lung and heart.
Klon CC1
Form Purified
Gen-Zugriffsnummer P23946
Konjugat Unconjugated
Isotype IgG1
Gensymbole CMA1
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4C. Do not freeze.
Klassifikation Monoclonal
Antigen Chymase/CMA1/Mast Cell Chymase
Regulatorischer Status RUO
Immunogen BALB/C mice were injected with a purified human skin chymase.
Zielspezies Human
Forschungsgebiet Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers
Wirtsspezies Mouse
Reinigungsverfahren Protein A or G purified
Gen-Alias Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891
Gen-ID (Entrez) 1215
4

Epredia™ Lab Vision™ Desmin (Muscle Cell Marker) Ab-1, Mouse Monoclonal Antibody

Specifically detect desmin in human, baboon, monkey, cow, cat, dog, hamster, rat and chicken samples.

Klassifikation Monoclonal
Antigen Desmin (Muscle Cell Marker) Ab-1
Regulatorischer Status IVD
Klon D33
Immunogen Desmin from human muscle
Forschungsgebiet Muscle Biology
Wirtsspezies Mouse
Konjugat Unconjugated
Anwendungen Immunofluorescence,Immunohistochemistry (Paraffin)
Primär oder sekundär Primary
5

CD31/PECAM-1 (Endothelial Cell Marker) Rabbit Polyclonal Antibody, Epredia™

Ensure accurate, reproducible results in immunohistochemistry procedures with Epredia™ CD31/PECAM-1 (Endothelial Cell Marker), Rabbit Polyclonal Antibody.

Klassifikation Polyclonal
Antigen CD31 (Endothelial Cell Marker)
Regulatorischer Status RUO
Immunogen Synthetic peptide corresponding to C-terminus of mouse CD31 protein
Zielspezies Human
Forschungsgebiet Cancer and Tumor Biology
Wirtsspezies Rabbit
Konjugat Unconjugated
Reinigungsverfahren Tonsil
Anwendungen Immunohistochemistry (Paraffin)
Primär oder sekundär Primary
6

Mast Cell Marker Antibody (MCG35) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody

Klon MCG35
Form Purified
Konjugat Unconjugated
Isotype IgG1 κ
Konzentration 1 mg/mL
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Zusammensetzung PBS
Klassifikation Monoclonal
Antigen Mast Cell Marker
Regulatorischer Status RUO
Immunogen Spleen cells and bone marrow cells (erythrocyte depleted) from a patient with systemic mastocytosis. The bone marrow preparation consisted of 50% typical mast cells.
Zielspezies Human
Forschungsgebiet Cardiovascular Biology
Wirtsspezies Mouse
Reinigungsverfahren Protein A purified
Anwendungen Immunohistochemistry
Verdünnung Immunohistochemistry 1:10 - 1:500
7

L1 Cell Adhesion Molecule Ab-1 Mouse Monoclonal Antibody, Epredia™

Recommended for Immunohistochemistry (Formalin/paraffin), Western Blotting and Immunoprecipitation (Native and denatured), Epredia™ L1 Cell Adhesion Molecule Ab-1, Mouse Monoclonal Antibody provides accurate, reproducible results.

Klassifikation Monoclonal
Antigen L1 Cell Adhesion Molecule Ab-1
Regulatorischer Status RUO
Klon UJ127
Immunogen Homogenous suspension of 16 week human fetal brain
Zielspezies Human
Forschungsgebiet Cancer and Tumor Biology
Wirtsspezies Mouse
Isotype IgG2a κ
Anwendungen Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Primär oder sekundär Primary
8

Epredia™ Lab Vision™ CD3 (Early T-Cell Marker) Rabbit Monoclonal Antibody,

Stain normal and neoplastic T cells in formalin-fixed, paraffin-embedded tissues with Epredia™ CD3 (Early T-Cell Marker), Rabbit Monoclonal Antibody.

Klassifikation Monoclonal
Antigen CD3
Regulatorischer Status IVD
Klon SP7
Immunogen A synthetic 13-mer peptide corresponding to aa 156-168 of the epsilon-chain of human CD3 protein
Forschungsgebiet Cancer and Tumor Biology
Wirtsspezies Rabbit
Konjugat Unconjugated
Anwendungen Immunohistochemistry (Paraffin)
Primär oder sekundär Primary
9

Panendothelial Cell Antigen Antibody (MECA-32), Alexa Fluor™ 488, Novus Biologicals™

Rat Monoclonal Antibody

Klon MECA-32
Form Purified
Konjugat Alexa Fluor 488
Isotype IgG2a κ
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4°C in the dark.
Zusammensetzung 50mM Sodium Borate
Klassifikation Monoclonal
Antigen Panendothelial Cell Antigen
Regulatorischer Status RUO
Immunogen Mouse lymph node stromal cells.
Zielspezies Human,Mouse
Forschungsgebiet Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Extracellular Matrix, Hypoxia, Immunology, Mesenchymal Stem Cell Markers, Stem Cell Markers
Wirtsspezies Rat
Reinigungsverfahren Protein G purified
Anwendungen Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry/Immunofluorescence,Immunoprecipitation
Gen-Alias FELS, Fenestrated endothelial-linked structure protein, gp68, MECA32, MECA-32, Panendothelial Cell Antigen, plasmalemma vesicle associated protein, Plasmalemma Vesicle Protein 1, PV-1 protein
Gen-ID (Entrez) 84094
10

Epredia™ Lab Vision™ CD79a/mb-1 (B-Cell Marker), Rabbit Monoclonal Antibody

Obtain accurate, reproducible results in immunohistochemistry experiments with Epredia™ CD79a/mb-1 (B-Cell Marker), Rabbit Monoclonal Antibody.

Klassifikation Monoclonal
Antigen CD79a/mb-1 (B-Cell Marker)
Regulatorischer Status IVD
Klon SP18
Immunogen Synthetic peptide derived from N-terminal region of human CD79a protein
Forschungsgebiet Cancer and Tumor Biology
Wirtsspezies Rabbit
Konjugat Unconjugated
Anwendungen Immunohistochemistry (Paraffin)
Primär oder sekundär Primary
11

Renal Cell Carcinoma Marker (gp200) Ab-1 Mouse Monoclonal Antibody, Epredia™

Provide accurate, reproducible results with the Epredia™ Renal Cell Carcinoma Marker (gp200) Ab-1, Mouse Monoclonal Antibody.

Klassifikation Monoclonal
Antigen Renal Cell Carcinoma Marker (gp200) Ab-1
Regulatorischer Status IVD
Klon PN-15
Immunogen Microsomal fraction of human renal cortical tissue homogenate
Forschungsgebiet Cancer and Tumor Biology
Wirtsspezies Mouse
Anwendungen Immunohistochemistry (Paraffin),Western Blot
Primär oder sekundär Primary
12

Chymase/CMA1/Mast Cell Chymase Rabbit anti-Human, Mouse, Rat, Clone: 2O4P8, Novus Biologicals™

Rabbit Monoclonal Antibody

Klon 2O4P8
Form Purified
Konjugat Unconjugated
Isotype IgG
Primär oder sekundär Primary
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS, 0.05% BSA, 50% glycerol, pH7.3
Klassifikation Monoclonal
Antigen Chymase/CMA1/Mast Cell Chymase
Regulatorischer Status RUO
Immunogen A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Chymase/CMA1/Mast Cell Chymase (CMA1) (P23946). GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Zielspezies Human,Mouse,Rat
Forschungsgebiet Cell Biology, Cellular Markers, Immunology, Innate Immunity, Mast Cell Markers
Wirtsspezies Rabbit
Reinigungsverfahren Affinity purified
Anwendungen Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Verdünnung Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Gen-Alias Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891
Gen-ID (Entrez) 1215
13

Zebrafish Gut Secretory Cell Epitopes Antibody (FIS 6G5/1) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody

Klon FIS 6G5/1
Form Purified
Konjugat Unconjugated
Isotype IgG1
Konzentration 0.9 mg/mL
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Zusammensetzung PBS
Klassifikation Monoclonal
Antigen Zebrafish Gut Secretory Cell Epitopes
Regulatorischer Status RUO
Immunogen Lysate of zebrafish intestine
Zielspezies Zebrafish
Forschungsgebiet Cell Cycle and Replication, Cellular Signaling, Developmental Biology, Epigenetics, Epitope Tags
Wirtsspezies Mouse
Reinigungsverfahren Protein A purified
Anwendungen Western Blot,ELISA,Immunohistochemistry,Immunofluorescence
Verdünnung Western Blot 1:200, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/ Immunofluorescence 1:10 - 1:500
14

Zebrafish Gut Absorptive Cell Epitopes Antibody (FIS 4E8/1) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody

Klon FIS 4E8/1
Form Purified
Konjugat Unconjugated
Isotype IgG1
Konzentration 1 mg/mL
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Zusammensetzung PBS
Klassifikation Monoclonal
Antigen Zebrafish Gut Absorptive Cell Epitopes
Regulatorischer Status RUO
Immunogen Lysate of zebrafish intestines
Zielspezies Zebrafish
Forschungsgebiet Cell Cycle and Replication, Cellular Signaling, Developmental Biology, Epigenetics, Epitope Tags
Wirtsspezies Mouse
Reinigungsverfahren Protein A purified
Anwendungen Western Blot,Immunohistochemistry,Immunoprecipitation
Verdünnung Western Blot 1:200, Immunohistochemistry 1:10 - 1:500, Immunoprecipitation 1:10 - 1:500
15

Zebrafish Gut Secretory Cell Epitopes Antibody (FIS 4B7/2) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody

Klon FIS 4B7/2
Form Purified
Konjugat Unconjugated
Isotype IgG1
Konzentration 1 mg/mL
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Zusammensetzung PBS
Klassifikation Monoclonal
Antigen Zebrafish Gut Secretory Cell Epitopes
Regulatorischer Status RUO
Immunogen Lysate of fish intestine
Zielspezies Zebrafish
Forschungsgebiet Cell Cycle and Replication, Cellular Signaling, Developmental Biology, Epigenetics, Epitope Tags
Wirtsspezies Mouse
Reinigungsverfahren Protein A purified
Anwendungen Western Blot,Immunohistochemistry,Immunofluorescence
Verdünnung Western Blot 1:200, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/ Immunofluorescence 1:10 - 1:500