missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF607 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
568.00 CHF
Spezifikation
| Antigen | ZNF607 |
|---|---|
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18278597
|
Novus Biologicals
NBP1-80125 |
100 μL |
568.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
ZNF607 Polyclonal specifically detects ZNF607 in Human samples. It is validated for Western Blot.Spezifikation
| ZNF607 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ14802, MGC13071, zinc finger protein 607 | |
| ZNF607 | |
| IgG | |
| 81 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_116078 | |
| 84775 | |
| Synthetic peptide directed towards the middle region of human ZNF607. Peptide sequence KECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFESV. | |
| Primary |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts