missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF607 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-80125
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
ZNF607 Polyclonal specifically detects ZNF607 in Human samples. It is validated for Western Blot.
Spezifikation
| ZNF607 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| FLJ14802, MGC13071, zinc finger protein 607 | |
| Rabbit | |
| 81 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_116078 | |
| ZNF607 | |
| Synthetic peptide directed towards the middle region of human ZNF607. Peptide sequence KECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFESV. | |
| Affinity purified | |
| RUO | |
| 84775 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur