missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF238 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
345.00 CHF - 802.00 CHF
Spezifikation
| Antigen | ZNF238 |
|---|---|
| Verdünnung | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Anwendungen | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18634244
|
Novus Biologicals
NBP3-21367-100ul |
100 μg |
802.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18623384
|
Novus Biologicals
NBP3-21367-25ul |
25 μg |
345.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
ZNF238 Polyclonal antibody specifically detects ZNF238 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Spezifikation
| ZNF238 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| NIZP1, NSD1 (nuclear receptor binding SET-domain containing 1)-interacting zinc fingerprotein 1, zinc finger protein 496, Zinc finger protein with KRAB and SCAN domains 17, ZKSCAN17MGC15548 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 10472 | |
| IgG | |
| Affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts