missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF238 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP3-21367-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
ZNF238 Polyclonal antibody specifically detects ZNF238 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
| ZNF238 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| NIZP1, NSD1 (nuclear receptor binding SET-domain containing 1)-interacting zinc fingerprotein 1, zinc finger protein 496, Zinc finger protein with KRAB and SCAN domains 17, ZKSCAN17MGC15548 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10472 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur