missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. YY2 Antibody - Azide and BSA Free, R&D Systems™

YY2 Antibody - Azide and BSA Free, R&D Systems™

Artikelnummer. 18603160 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Menge:
0.02 mL
0.1 mL
Pakningsstørrelse:
0.02 Milliliter
0.10 Milliliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge Pakningsstørrelse
18603160 0.02 mL 0.02 Milliliter
18660751 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18603160 Leverandør Novus Biologicals Leverandørnr. NBP2939050.02ml
 Eingeschränkter Artikel
Verfügbar ab: 02-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

YY2 Polyclonal specifically detects YY2 in Human, Mouse, Rat samples. It is validated for ELISA, Immunocytochemistry/Immunofluorescence, Western Blot.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen YY2
Anwendungen ELISA, Immunocytochemistry/Immunofluorescence, Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
Zusammensetzung PBS (pH 7.3), 50% glycerol
Gen-Alias transcription factor YY2, YY2 transcription factor, ZNF631
Wirtsspezies Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY2 (NP_996806.2). GEGQAENPPDYSEYLKGKKLPPGGLPGIDLSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRR
Reinigungsverfahren Affinity purified
Menge 0.02 mL
Regulatorischer Status RUO
Forschungsgebiet Endocrinology
Primär oder sekundär Primary
Gen-ID (Entrez) 404281
Zielspezies Human, Mouse, Rat
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.