Gefilterte Suchergebnisse
Produkte von einigen unserer Lieferanten werden in den gefilterten Suchergebnissen nicht angezeigt. Bitte
deaktivieren Sie alle Filter,
um diese Produkte zu sehen.
1
–
15
von
951,843
Ergebnisse
Rabbit IgG Isotype Control, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 36 publications
Histone H2AX, p Ser139 Antibody (3F2), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 6 publications
| Testspezifität | In Western blot this antibody detects ∼17 kDa protein representing phosphorylated H2AX in gamma irradiated HeLa cell lysate. In immunofluorescence procedures, recognizes phosphorylated H2AX in gamma irradiated HeLa cells. ELISA of phosphorylated H2AX can also be performed. Used in IHC to successfully detect H2A.X pSer140 in postnatal mouse lung section. |
|---|---|
| Klon | 3F2 |
| Form | Purified |
| Gen-Zugriffsnummer | P16104 |
| Konjugat | Unconjugated |
| Isotype | IgG1 κ |
| Gensymbole | H2AFX |
| Konzentration | 1 mg/mL |
| Primär oder sekundär | Primary |
| Molekulargewicht des Antigens | 15 kDa |
| Inhalt und Lagerung | Store at -20°C. Avoid freeze/thaw cycles. |
| Klassifikation | Monoclonal |
| Antigen | Histone H2AX (p Ser139) |
| Regulatorischer Status | RUO |
| Immunogen | This Histone H2AX [p Ser139] Antibody (3F2) was developed against a synthetic peptide sequence surrounding phosphorylated Ser139. |
| Zielspezies | Human |
| Forschungsgebiet | Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Epigenetics, Mitotic Regulators, Phospho Specific |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Western Blot |
| Verdünnung | Western Blot 1 μg/mL, Simple Western 10 μg/mL, Flow Cytometry 1 μg 106 cells, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 2 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10 - 1:500 |
| Gen-Alias | H2A.X, H2A/X, H2AFX |
| Gen-ID (Entrez) | 3014 |
| Zusammensetzung | Lyophilized from additive free solution. |
|---|---|
| Lagerungsbedingungen | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Forschungskategorie | Epitope Tags |
| Molekulargewicht | 33.4 kDa |
| Rekonstitution | Dissolve in distilled water or saline. |
| Zur Verwendung mit (Anwendung) | PAGE,Bioactivity,HPLC |
| Konzentration | LYOPH |
| Endotoxin-Konzentration | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Gen-Alias | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| Protein | Protein A |
| Reinheits- oder Qualitätsgrad | >97% pure by SDS-PAGE and HPLC |
| Gen-ID (Entrez) | 3919448 |
Coagulation Factor III/Tissue Factor Antibody (SN20-16), Novus Biologicals™
Rabbit Monoclonal Antibody
| Klon | SN20-16 |
|---|---|
| Form | Purified |
| Konjugat | Unconjugated |
| Isotype | IgG |
| Gensymbole | F3 |
| Konzentration | 1 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | TBS (pH7.4), 0.05% BSA, 40% Glycerol with 0.05% Sodium Azide |
| Klassifikation | Monoclonal |
| Antigen | CoagulationFactorIII/TissueFactor |
| Immunogen | Synthetic peptide within human Coagulation Factor III/Tissue Factor aa 30-70. (SwissProt: P13726 Human; SwissProt: P20352 Mouse; SwissProt: P42533 Rat) |
| Forschungsgebiet | Cancer |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Protein A purified |
| Verdünnung | Western Blot 1:100-1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 1:100-1:500, Immunohistochemistry-Paraffin 1:100-1:500 |
| Gen-Alias | CD142, CD142 antigen, Coagulation factor III, coagulation factor III (thromboplastin, tissue factor), FLJ17960, TF, TFA, Thromboplastin, tissue factor |
| Gen-ID (Entrez) | 2152 |
| Wirtsspezies | Rabbit |
|---|---|
| Anwendungen | Immunohistochemistry (Paraffin) |
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Klon | XJ11-1B12 |
|---|---|
| Form | Purified |
| Gen-Zugriffsnummer | Q14674 |
| Konjugat | Unconjugated |
| Isotype | IgG1 κ |
| Gensymbole | ESPL1 |
| Konzentration | 0.9 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Klassifikation | Monoclonal |
| Antigen | Separase |
| Regulatorischer Status | RUO |
| Immunogen | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Zielspezies | Human |
| Forschungsgebiet | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Western Blot |
| Verdünnung | Western Blot 1:500 |
| Gen-Alias | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Gen-ID (Entrez) | 9700 |
Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1), Alexa Fluor™ 647, Novus Biologicals™
Mouse Monoclonal Antibody
| Testspezifität | Specificity of human USH1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
|---|---|
| Konjugat | Unconjugated |
| Isotype | IgG |
| Gensymbole | USH1C |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Klassifikation | Polyclonal |
| Antigen | USH1C |
| Regulatorischer Status | RUO |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE |
| Zielspezies | Human,Mouse |
| Forschungsgebiet | Signal Transduction, Vision |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Anwendungen | Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Verdünnung | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Gen-Alias | AIE75, AIE-75, Antigen NY-CO-38/NY-CO-37, Autoimmune enteropathy-related antigen AIE-75, deafness, autosomal recessive 18, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-45, PDZ73, PDZ-73, PDZ-73/NY-CO-38, Protein PDZ-73, Renal carcinoma antigen NY-REN-3, ush1cpst, Usher syndrome 1C (autosomal recessive, severe), Usher syndrome type-1C protein |
| Gen-ID (Entrez) | 10083 |