missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ TYW1B Recombinant Protein Antigen

Artikelnummer. 18159967 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
0,1 mL
Packungsgröße:
0.10 Milliliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18159967 0,1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18159967 Lieferant Novus Biologicals™ Lieferanten-Nr. NBP238563PEP

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TYW1B. The TYW1B Recombinant Protein Antigen is derived from E. coli. The TYW1B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-38563. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Spezifikation

Gene ID (Entrez) 55253
Spezies Human
Reinigungsverfahren Chromatography
Reinheit >80%
Konzentration 0.5mg/mL
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gen-Alias LINC00069, Long Intergenic Non-Protein Coding RNA 69, NCRNA00069, Non-Protein Coding RNA 69, Radical S-Adenosyl Methionine And Flavodoxin Domain-Containing Protein 2, radical S-adenosyl methionine and flavodoxin domains 1, RSAFD2, S-Adenosyl-L-Methionine-Dependent TRNA 4-Demethylwyosine Synthase, TRNA Wybutosine-Synthesizing Protein 1 Homolog B TRNA-YW Synthesizing Protein 1 Homolog B, TRNA-YW Synthesizing Protein 1 Homolog B (Non-Protein Coding), TRNA-YW Synthesizing Protein 1 Homolog B (S. Cerevisiae)
Gensymbol TYW1
Markertyp Unmarkiert
Molekulargewicht 27kDa
Produkttyp TYW1
Menge 0,1 mL
Kennzeichnung RUO
Quelle E.Coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38563. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen RVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSQEQDELHHR
Mehr anzeigen Weniger anzeigen

Nur für Forschungszwecke

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.