missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemische Reagenzien
  4. Peptide
  5. 18159967

Novus Biologicals™ TYW1B Recombinant Protein Antigen

Artikelnummer. 18159967 Alle ansehen Bio Techne Produkte
missing translation for 'orderingAttributeHoverText'
Menge:
0,1 mL
missing translation for 'unitSize'
0.10 Milliliter
This item is not returnable. View return policy

Product Code. 18159967

missing translation for 'mfr': Novus Biologicals™ NBP238563PEP

om dit product te kopen Registreer vandaag om een webaccount aan te maken

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TYW1B. The TYW1B Recombinant Protein Antigen is derived from E. coli. The TYW1B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-38563. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 55253
Spezies Human
Reinigungsverfahren Chromatography
Reinheit >80%
Konzentration 0.5mg/mL
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gen-Alias LINC00069, Long Intergenic Non-Protein Coding RNA 69, NCRNA00069, Non-Protein Coding RNA 69, Radical S-Adenosyl Methionine And Flavodoxin Domain-Containing Protein 2, radical S-adenosyl methionine and flavodoxin domains 1, RSAFD2, S-Adenosyl-L-Methionine-Dependent TRNA 4-Demethylwyosine Synthase, TRNA Wybutosine-Synthesizing Protein 1 Homolog B TRNA-YW Synthesizing Protein 1 Homolog B, TRNA-YW Synthesizing Protein 1 Homolog B (Non-Protein Coding), TRNA-YW Synthesizing Protein 1 Homolog B (S. Cerevisiae)
Gensymbol TYW1
Markertyp Unmarkiert
Molekulargewicht 27kDa
Produkttyp TYW1
Menge 0,1 mL
Kennzeichnung RUO
Quelle E.Coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38563. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen RVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSQEQDELHHR
Show More Show Less

Nur für Forschungszwecke

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.