missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ TYW1 Recombinant Protein Antigen
Alle ansehen Bio Techne Produkte
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TYW1. Source: E.coli Amino Acid Sequence: GFATVLAEAVTSLDLPVAIINLKEYDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMR The TYW1 Recombinant Protein Antigen is derived from E. coli. The TYW1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Spezifikation
Spezifikation
| Gene ID (Entrez) | 55253 |
| Reinigungsverfahren | >80% by SDS-PAGE and Coomassie blue staining |
| Gebräuchliche Bezeichnung | TYW1 Recombinant Protein Antigen |
| Inhalt und Lagerung | Store at −20C. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS and 1M Urea, pH 7.4. |
| Zur Verwendung mit (Anwendung) | Blocking/Neutralizing, Control |
| Gen-Alias | FLJ10900, MGC23001, MGC60291, Radical S-adenosyl methionine and flavodoxin domain-containing protein 1, radical S-adenosyl methionine and flavodoxin domains 1, RSAFD1, tRNA wybutosine-synthesizing protein 1 homolog, tRNA-yW synthesizing protein 1 homolog |
| Gensymbol | TYW1 |
| Markertyp | Unmarkiert |
| Produkttyp | Recombinant Protein Antigen |
| Mehr anzeigen |
Nur für Forschungszwecke
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur