missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 18607565

DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - IHC-Prediluted, R&D Systems™

Artikelnummer. 18607565 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
7 mL
Packungsgröße:
7 Milliliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge Packungsgröße
18607565 7 mL 7 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18607565 Lieferant Novus Biologicals Lieferanten-Nr. NBP244381
 Eingeschränkter Artikel
Verfügbar ab: 26-11-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Description

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

DOG1/TMEM16A Monoclonal antibody specifically detects DOG1/TMEM16A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen DOG1/TMEM16A
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Monoclonal
Klon DG1/447 + DOG-1.1
Konjugat Unconjugated
Verdünnung Immunohistochemistry, Immunohistochemistry-Paraffin 0.25 - 0.5 μg/mL
Zusammensetzung 10 mM PBS with 0.05% BSA
Gen-Alias ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Wirtsspezies Mouse
Immunogen Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6)
Reinigungsverfahren Protein A or G purified
Menge 7 mL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 55107
Zielspezies Human
Inhalt und Lagerung Store at 4°C.
Produkttyp Antibody
Form Purified
Isotype IgG1 κ
Produktlinie Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.