missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Alle ansehen Bio Techne Produkte
Click to view available options
Menge:
5 mg
Packungsgröße:
5 Milligramm
Spezifikation
Spezifikation
| Wirtsspezies | Human, Mouse |
| Komponenten | TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361. |
| Zur Verwendung mit (Anwendung) | Inhibition of TIRAP binding to TLR2 or TLR4 |
| Inhalt und Lagerung | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Menge | 5 mg |
| Produkttyp | TIRAP (TLR2 and TLR4) Inhibitor Peptide Set |
| Molekulargewicht | 3701.4 |
| Hemmstoffe | TLR2, TLR4 |
| Form | Lyophilisiert |
For Research Use Only
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur