missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. SLC35A5 Antibody, R&D Systems™

SLC35A5 Antibody, R&D Systems™

Artikelnummer. 18614317 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
25 μL
100 μL
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge Packungsgröße
18614317 25 μL 25 Mikroliter
18226684 100 μL 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18614317 Lieferant Novus Biologicals Lieferanten-Nr. NBP25824025ul
  • ONLINE EXCLUSIVE PRICE
    517.15 CHF
    443.10 CHF / 25 Mikroliter
    Sparen 74.05 CHF
    14% Rabatt
 Eingeschränkter Artikel
Verfügbar ab: 01-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SLC35A5 Polyclonal specifically detects SLC35A5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen SLC35A5
Anwendungen Immunocytochemistry, Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Zusammensetzung PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gen-Alias DKFZp434E102, FLJ11130, FLJ20730, FLJ25973, probable UDP-sugar transporter protein SLC35A5, Solute carrier family 35 member A5, solute carrier family 35, member A5
Gensymbole SLC35A5
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDTF
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 55032
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Produkttyp Antibody
Isotype IgG
Produktlinie Novus
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.