missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 18414089

TAF8 Antibody, Novus Biologicals™

Artikelnummer. 18414089 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.05 mg
Packungsgröße:
50 Mikrogramm
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18414089 0.05 mg 50 Mikrogramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18414089 Lieferant Novus Biologicals Lieferanten-Nr. H00129685B01P

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse Polyclonal Antibody

TAF8 Polyclonal antibody specifically detects TAF8 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen TAF8
Anwendungen Western Blot, Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 1:500, Immunocytochemistry/ Immunofluorescence
Zusammensetzung PBS (pH 7.4)
Gen-Alias 45/50kDa, FLJ32821, II, Protein taube nuss, RNA polymerase II, 43 kD, TAF(II)43,43, TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa, TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, taube nuss homolog (mouse), TBP-associated factor 43 kDa, TBP-associated factor 8, transcription initiation factor TFIID subunit 8
Wirtsspezies Mouse
Immunogen TBN (AAH33728.1, 1 a.a. - 174 a.a.) full-length human protein. MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPVSDEALGLRVV
Reinigungsverfahren Protein A purified
Menge 0.05 mg
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 129685
Zielspezies Human
Inhalt und Lagerung Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.