missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. SRGAP3 Antibody, R&D Systems™

SRGAP3 Antibody, R&D Systems™

Product Code. 18602596 Shop All Bio Techne Products
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Menge:
25 μL
0.1 mL
missing translation for 'unitSize':
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge missing translation for 'unitSize'
18602596 25 μL 25 Mikroliter
18194689 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
This item is not returnable. View return policy
Product Code. 18602596 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP23852125ul
 Eingeschränkter Artikel
Verfügbar ab: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SRGAP3 Polyclonal specifically detects SRGAP3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SRGAP3
Anwendungen Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Zugriffsnummer O43295
Gen-Alias SLIT-ROBO Rho GTPase activating protein 2, SLIT-ROBO Rho GTPase activating protein 3
Gensymbole SRGAP3
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RIESPEKRRMATFGSAGSINYPDKKALSEGHSMRSTCGSTRHSSLGDHKSLEAEALAEDIEKTMSTA
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 9901
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Produkttyp Antibody
Isotype IgG
Produktlinie Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.