missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemische Reagenzien
  4. Peptide
  5. 18212581

Novus Biologicals™ Serine racemase Recombinant Protein Antigen

Artikelnummer. 18212581 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18212581 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18212581 Lieferant Novus Biologicals™ Lieferanten-Nr. NBP258903PEP

om dit product te kopen Registreer vandaag om een webaccount aan te maken

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Serine racemase. Source: E.coli Amino Acid Sequence: QVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQ The Serine racemase Recombinant Protein Antigen is derived from E. coli. The Serine racemase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 63826
Reinigungsverfahren >80% by SDS-PAGE and Coomassie blue staining
Gebräuchliche Bezeichnung Serine racemase Recombinant Protein Antigen
Inhalt und Lagerung Store at −20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gen-Alias D-serine ammonia-lyase, D-serine dehydratase, EC 4.3.1.17, EC 4.3.1.18, EC 5.1.1.18, ILV1, ISO1, L-serine ammonia-lyase, L-serine dehydratase, serine racemase
Gensymbol SRR
Markertyp Unmarkiert
Produkttyp Recombinant Protein Antigen
Menge 100 μl
Kennzeichnung RUO
Quelle E. coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51059. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

Nur für Forschungszwecke.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.