missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. RSK3 Antibody, Novus Biologicals™

RSK3 Antibody, Novus Biologicals™

Artikelnummer. 18625946 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
25 μL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18625946 25 μL 25 Mikroliter
18606065 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18625946 Lieferant Novus Biologicals Lieferanten-Nr. NBP24882525ul

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

RSK3 Polyclonal antibody specifically detects RSK3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen RSK3
Anwendungen Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Zusammensetzung PBS (pH 7.2), 40% Glycerol
Gen-Alias EC 2.7.11, EC 2.7.11.1, HU-2, MAP kinase-activated protein kinase 1c, MAPK-activated protein kinase 1c, MAPKAP kinase 1c, MAPKAPK-1c, MAPKAPK1C, p90-RSK 2, p90RSK2, p90-RSK3, ribosomal protein S6 kinase alpha 2, ribosomal protein S6 kinase alpha-2, ribosomal protein S6 kinase, 90kD, polypeptide 2, ribosomal protein S6 kinase, 90kDa, polypeptide 2, Ribosomal S6 kinase 3,90 kDa ribosomal protein S6 kinase 2, RSK, RSK-3, RSK3pp90RSK3, S6K-alpha, S6K-alpha2, S6K-alpha-2
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGF
Reinigungsverfahren Immunogen affinity purified
Menge 25 μL
Regulatorischer Status RUO
Forschungsgebiet Protein Kinase
Primär oder sekundär Primary
Gen-ID (Entrez) 6196
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.