missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant West Nile Virus WNV Pre-M Protein
A cDNA sequence encoding the WNV Pre-M was constructed and used to recombinantly synthesize the protein.
Marke: enQuireBio™ QP13965-500ug
Additional Details : Gewicht : 0.01000kg
Spezifikation
| West Nile Virus WNV Pre-M Protein | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE | |
| Protein is >95% pure as determined by SDS-PAGE. |
| 500 μg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| West Nile Virus | |
| His | |
| 20mM phosphate buffer pH 7.5. |