missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)
Highly purified and high bioactivity. Generating reliable and reproducible results.
726.00 CHF - 2075.00 CHF
Spezifikation
Zur Verwendung mit (Anwendung) | In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot |
---|---|
Zusammensetzung | PBS |
Gen-ID (Entrez) | 6622 |
Name | Human alpha-Synuclein Aggregate Protein |
Reinigungsverfahren | >95% pure by SDS-PAGE |
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | ||||||
---|---|---|---|---|---|---|---|---|---|---|
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | ||||||
18735843
|
Novus Biologicals™
NBP2-54789-100UG |
100 μg |
726.00 CHF
1 Set |
Verfügbar ab: 13-08-2025
Loggen Sie sich ein, um den Lagerbestand zu sehen |
Sie haben bereits ein Konto? Melden Sie sich an um den Preis und die Verfügbarkeit zu sehen. Neu hier? Registrieren Sie sich noch heute bei uns! |
|||||
18681109
|
Novus Biologicals™
NBP2-54789-200ug |
200 μg | ||||||||
18624596
|
Novus Biologicals™
NBP2-54789-500ug |
500 μg | ||||||||
Beschreibung
An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.Spezifikation
In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot | |
6622 | |
>95% pure by SDS-PAGE | |
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA | |
alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor) | |
Recombinant Protein | |
Human |
PBS | |
Human alpha-Synuclein Aggregate Protein | |
E.Coli | |
RUO | |
SNCA | |
Unconjugated | |
Recombinant |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)