missing translation for 'onlineSavingsMsg'
Learn More

RBM26 Antibody, Novus Biologicals™

Artikelnummer. 18491801 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
25 μL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18491801 0.1 mL 0.10 Milliliter
18461031 25 μL 25 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18491801 Lieferant Novus Biologicals Lieferanten-Nr. NBP189007

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Rabbit Polyclonal Antibody

RBM26 Polyclonal antibody specifically detects RBM26 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen RBM26
Anwendungen Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin), KnockDown
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated
Zusammensetzung PBS (pH 7.2) and 40% Glycerol
Gen-Alias acidic rich RS domain containing 2, ARRS2, C13orf10, chromosome 13 open reading frame 10, CTCL tumor antigen se70-2, cutaneous T-cell lymphoma tumor antigen se70-2, FLJ20957, MGC133295, MGC133296, PRO1777, RNA binding motif protein 26, RNA-binding motif protein 26, RNA-binding protein 26, RP11-255E21.1, SE70-2, ZC3H17
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: PPLTPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTADTYDTDGY
Reinigungsverfahren Immunogen affinity purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet Cell Biology
Primär oder sekundär Primary
Gen-ID (Entrez) 64062
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.