missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBBP4/RbAp48 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-56286
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
RBBP4/RbAp48 Polyclonal specifically detects RBBP4/RbAp48 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
| RBBP4/RbAp48 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| CAF-1 subunit C, CAF-I p48, Chromatin assembly factor 1 subunit C, Chromatin assembly factor I p48 subunit, chromatin assembly factor/CAF-1 p48 subunit, histone-binding protein RBBP4, MSI1 protein homolog, Nucleosome-remodeling factor subunit RBAP48, NURF55, RbAp48, RBBP-4, retinoblastoma binding protein 4, Retinoblastoma-binding protein 4CAF-I 48 kDa subunit, Retinoblastoma-binding protein p48 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| RBBP4 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT | |
| 100 μL | |
| Cancer, Cell Cycle and Replication, Chromatin Research, Growth and Development, Stem Cell Markers, Tumor Suppressors | |
| 5928 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur