missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemische Reagenzien
  4. Peptide
  5. 18272623

Novus Biologicals™ PRAS40 Recombinant Protein Antigen

Artikelnummer. 18272623 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18272623 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18272623 Lieferant Novus Biologicals™ Lieferanten-Nr. NBP257165PEP
  • ONLINE EXCLUSIVE PRICE
    310.00 CHF
    292.95 CHF / 100 Mikroliter
    Sparen 17.05 CHF
    5% Rabatt
 Eingeschränkter Artikel
Verfügbar ab: 15-10-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRAS40. Source: E.coli Amino Acid Sequence: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK The PRAS40 Recombinant Protein Antigen is derived from E. coli. The PRAS40 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spezifikation

Gene ID (Entrez) 84335
Reinigungsverfahren >80% by SDS-PAGE and Coomassie blue staining
Gebräuchliche Bezeichnung PRAS40 Recombinant Protein Antigen
Inhalt und Lagerung Store at −20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gen-Alias 40 kDa, AKT1 substrate 1 (proline-rich), MGC2865, proline-rich AKT1 substrate 1,40 kDa proline-rich AKT substrate
Gensymbol AKT1S1
Markertyp Unmarkiert
Produkttyp Recombinant Protein Antigen
Menge 100 μl
Kennzeichnung RUO
Quelle E. coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51428. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Mehr anzeigen Weniger anzeigen

Nur für Forschungszwecke.

Name des Produkts
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.