missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. PPIL2 Antibody, R&D Systems™

PPIL2 Antibody, R&D Systems™

Artikelnummer. 18222012 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
100 μL
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge Packungsgröße
18222012 100 μL 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18222012 Lieferant Novus Biologicals Lieferanten-Nr. NBP154366
 Eingeschränkter Artikel
Verfügbar ab: 02-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PPIL2 Polyclonal specifically detects PPIL2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen PPIL2
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Klassifikation Polyclonal
Konzentration 0.5 mg/ml
Konjugat Unconjugated
Verdünnung Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Zusammensetzung PBS, 2% Sucrose with 0.09% Sodium Azide
Gen-Zugriffsnummer Q13356
Gen-Alias CYC4, cyclophilin, 60kDa, cyclophilin-60, Cyclophilin-like protein Cyp-60, Cyp-60, CYP60, EC 5.2.1.8, FLJ39930, hCyP-60, MGC33174, MGC787, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase-like 2, peptidylprolyl isomerase (cyclophilin)-like 2, PPIase, Rotamase PPIL2
Gensymbole PPIL2
Wirtsspezies Rabbit
Immunogen Synthetic peptides corresponding to PPIL2(peptidylprolyl isomerase (cyclophilin)-like 2) The peptide sequence was selected from the C terminal of PPIL2. Peptide sequence GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ.
Molekulargewicht des Antigens 59 kDa
Reinigungsverfahren Affinity purified
Menge 100 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 23759
Rekonstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Isotype IgG
Produktlinie Novus
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.