missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PAP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
317.00 CHF - 643.00 CHF
Spezifikation
| Antigen | PAP2 |
|---|---|
| Verdünnung | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18428171
|
Novus Biologicals
NBP1-91086-25ul |
25 μL |
317.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18252899
|
Novus Biologicals
NBP1-91086 |
0.1 mL |
643.00 CHF
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
PAP2 Polyclonal specifically detects PAP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| PAP2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 163404 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITAFAEVT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| lipid phosphate phosphatase-related protein type 5, phosphatidic acid phosphatase 2d, phosphatidic acid phosphatase type 2, PRG-5 | |
| PLPPR5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts