missing translation for 'onlineSavingsMsg'
Learn More

PAP2 Antibody, Novus Biologicals™

Artikelnummer. 18428171 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
0.1 mL
25 μL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18428171 25 μL 25 Mikroliter
18252899 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18428171 Lieferant Novus Biologicals Lieferanten-Nr. NBP19108625ul

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Rabbit Polyclonal Antibody

PAP2 Polyclonal specifically detects PAP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen PAP2
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Alias lipid phosphate phosphatase-related protein type 5, phosphatidic acid phosphatase 2d, phosphatidic acid phosphatase type 2, PRG-5
Gensymbole PLPPR5
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EHIHMDNLAQMPMISIPRVESPLEKVTSVQNHITAFAEVT
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 163404
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.