missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. p14ARF/CDKN2A Antibody, R&D Systems™

p14ARF/CDKN2A Antibody, R&D Systems™

Artikelnummer. 18621319 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
100 μg
25 μg
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge Packungsgröße
18621319 25 μg 25 Mikroliter
18635268 100 μg 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18621319 Lieferant Novus Biologicals Lieferanten-Nr. NBP30552125ul
 Eingeschränkter Artikel
Verfügbar ab: 01-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

p14ARF/CDKN2A Polyclonal specifically detects p14ARF/CDKN2A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen p14ARF/CDKN2A
Anwendungen Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Zusammensetzung PBS, pH 7.2, containing 40% glycerol
Gen-Alias ARF, CDK4 inhibitor p16-INK4, CDK4IP14ARF, CDKN2, cell cycle negative regulator beta, CMM2P16-INK4A, Cyclin-dependent kinase 4 inhibitor A, cyclin-dependent kinase inhibitor 2A, cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4), INK4, INK4A, MLMP16INK4, MTS-1, MTS1P14, Multiple tumor suppressor 1, p14, p14ARF, p16, p16-INK4, p16INK4a, p16-INK4a, P19, p19ARF, TP16
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPS
Reinigungsverfahren Affinity purified
Menge 25 μg
Regulatorischer Status RUO
Forschungsgebiet ABC Transporters, Cancer, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, Hypoxia, MAP Kinase Signaling, Neuroscience, p53 Pathway, Transcription Factors and Regulators, Tumor Suppressors
Primär oder sekundär Primary
Gen-ID (Entrez) 1029
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.