missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Ocular development associated gene Recombinant Protein Antigen
Alle ansehen Bio Techne Produkte
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ocular development associated gene. Source: E.coli Amino Acid Sequence: MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR The Ocular development associated gene Recombinant Protein Antigen is derived from E. coli. The Ocular development associated gene Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Spezifikation
Spezifikation
| Gene ID (Entrez) | 57798 |
| Reinigungsverfahren | >80% by SDS-PAGE and Coomassie blue staining |
| Gebräuchliche Bezeichnung | Ocular development associated gene Recombinant Protein Antigen |
| Inhalt und Lagerung | Store at −20°C. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS and 1M Urea, pH 7.4. |
| Zur Verwendung mit (Anwendung) | Blocking/Neutralizing, Control |
| Gen-Alias | FLJ22489, GATA zinc finger domain containing 1, GATA zinc finger domain-containing protein 1, ocular development associated, Ocular development-associated gene protein, ODAGFLJ40695, RG083M05.2 |
| Gensymbol | GATAD1 |
| Markertyp | Unmarkiert |
| Produkttyp | Recombinant Protein Antigen |
| Mehr anzeigen |
Nur für Forschungszwecke.
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur