missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 18281014

Novus Biologicals™ Recombinant Human IRF2 His Protein

Artikelnummer. 18281014 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0,1 mg
Packungsgröße:
0.10 Milligramm
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18281014 0,1 mg 0.10 Milligramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18281014 Lieferant Novus Biologicals™ Lieferanten-Nr. NBC118476

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-113 of Human IRF2 The Recombinant Human IRF2 Protein is derived from E. coli. The Recombinant Human IRF2 Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer NM_002190
Konzentration 1 mg/mL
Zur Verwendung mit (Anwendung) SDS-PAGE
Zusammensetzung 20 mM Tris buffer (pH 8.0), 10% glycerol, 1 mM DTT
Gen-ID (Entrez) 3660
Molekulargewicht M.W. (theoretical): 15 kDa
Name IRF2 Protein
Reinigungsverfahren Protein
Menge 0,1 mg
Immunogen MGSSHHHHHHSSGLVPRGSHMPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLP
Lagerungsbedingungen Store at 4 C short term. Aliquot and store (at -20 C long term. Avoid freeze-thaw cycles.)
Endotoxin-Konzentration <1.0 EU / 1 μg of protein (determined by LAL method)
Gensymbol IRF2
Kreuzreaktivität Human
Forschungskategorie Cytokine Research
Reinheits- oder Qualitätsgrad >95%, by SDS-PAGE
Protein IRF2
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.