missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. MRPL50 Antibody, R&D Systems™

MRPL50 Antibody, R&D Systems™

Artikelnummer. 18614387 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
100 μg
25 μL
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge Packungsgröße
18614387 25 μL 25 Mikroliter
18694538 100 μg 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Product Code. 18614387 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP26872825ul
  • ONLINE EXCLUSIVE PRICE
    517.15 CHF
    443.10 CHF / 25 Mikroliter
    Sparen 74.05 CHF
    14% Rabatt
 Eingeschränkter Artikel
Verfügbar ab: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

MRPL50 Polyclonal specifically detects MRPL50 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MRPL50
Anwendungen Immunocytochemistry, Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Zusammensetzung PBS (pH 7.2) and 40% Glycerol
Gen-Alias 39S ribosomal protein L50, mitochondrial, FLJ20493, L50mt, mitochondrial 39S ribosomal protein L50, mitochondrial ribosomal protein L50, MRP-L50FLJ21990
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWS
Reinigungsverfahren Protein A purified
Menge 25 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 54534
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.