Abnova™ MRPL13 Recombinant Protein

Name: Abnova&trade; MRPL13 Recombinant Protein
Brand: Abnova&trade;
SKU: 16128942
Price: 547.00 EUR

Brand: Abnova™ H00028998-P01.25ug

Additional Details : Gewicht : 0.00010kg

Product Code. 16128942

Quantity

Verfügbar ab: 11-06-2024
Sie sich ein, um den Lagerbestand zu sehen

Add to basket

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Zugriffsnummer	AAH09190
Zusammensetzung	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molekulargewicht	45.32
pH-Bereich	8
Reinigungsverfahren	Glutathione Sepharose 4 Fast Flow
Menge	25 ug
Immunogen	MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL
Gen-Alias	L13/L13A/L13mt/RPL13/RPML13
Gensymbol	MRPL13
Spezies	Wheat Germ (in vitro)
Proteinmarkierung	GST

Zur Verwendung mit (Anwendung)	Antibody Production, Protein Array, ELISA, Western Blot
Gen-ID (Entrez)	28998
Name	MRPL13 (Human) Recombinant Protein (P01)
Vorbereitungsmethode	In vitro wheat germ expression system
Qualitätskontrollen	12.5% SDS-PAGE Stained with Coomassie Blue.
Quelle	Wheat Germ (in vitro)
Lagerungsbedingungen	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gebräuchliche Bezeichnung	MRPL13
Kreuzreaktivität	Human
Rekombinant	Recombinant
Form	Solution

Product Suggestions

Description