missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ MRPL13 Recombinant Protein
361.00 CHF - 547.00 CHF
Spezifikation
| Zugriffsnummer | AAH09190 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, Protein Array, ELISA, Western Blot |
| Zusammensetzung | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gen-ID (Entrez) | 28998 |
| Molekulargewicht | 45.32 |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16118942
|
Abnova™
H00028998-P01.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab: 30-05-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
|
16128942
|
Abnova™
H00028998-P01.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab: 30-05-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Beschreibung
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spezifikation
| AAH09190 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 45.32 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MRPL13 | |
| Human | |
| Recombinant | |
| Solution |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 28998 | |
| MRPL13 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL | |
| L13/L13A/L13mt/RPL13/RPML13 | |
| MRPL13 | |
| Wheat Germ (in vitro) | |
| GST |