missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemische Reagenzien
  4. Peptide
  5. 18144219

Novus Biologicals™ Methionine Aminopeptidase 1/METAP1 Recombinant Protein Antigen

Artikelnummer. 18144219 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
0,1 mL
Packungsgröße:
0.10 Milliliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18144219 0,1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18144219 Lieferant Novus Biologicals™ Lieferanten-Nr. NBP238375PEP
 Eingeschränkter Artikel
Verfügbar ab: 15-10-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human METAP1. The Methionine Aminopeptidase 1/METAP1 Recombinant Protein Antigen is derived from E. coli. The Methionine Aminopeptidase 1/METAP1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-38375. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 23173
Spezies Human
Reinigungsverfahren Chromatography
Reinheit >80%
Konzentration 0.5mg/mL
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gensymbol METAP1
Markertyp Unmarkiert
Molekulargewicht 26kDa
Produkttyp Methionine Aminopeptidase 1/METAP1
Menge 0,1 mL
Kennzeichnung RUO
Forschungskategorie metabolism, Proteases & Other Enzymes
Quelle E.Coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38375. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen SVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEH
Show More Show Less

Nur für Forschungszwecke

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.