missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. MED9 Antibody, R&D Systems™

MED9 Antibody, R&D Systems™

Artikelnummer. 18120484 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
25 μL
0.1 mL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge Packungsgröße
18120484 0.1 mL 0.10 Milliliter
18457391 25 μL 25 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18120484 Lieferant Novus Biologicals Lieferanten-Nr. NBP231639
  • ONLINE EXCLUSIVE PRICE
    704.47 CHF
    664.65 CHF / 0.1 Milliliter
    Sparen 39.82 CHF
    5% Rabatt
 Eingeschränkter Artikel
Verfügbar ab: 02-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

MED9 Polyclonal specifically detects MED9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin).

TRUSTED_SUSTAINABILITY

Spezifikation

Antigen MED9
Anwendungen Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Zugriffsnummer Q9NWA0
Gen-Alias FLJ10193mediator of RNA polymerase II transcription, subunit 9 homolog, MED25mediator of RNA polymerase II transcription subunit 9, mediator complex subunit 9MGC138234, mediator of RNA polymerase II transcription, subunit 9 homolog (S. cerevisiae), mediator subunit 25
Gensymbole MED9
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPP
Reinigungsverfahren Affinity Purified
Menge 0.1 mL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 55090
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Isotype IgG
Produktlinie Novus
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.