missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ST13 Full-length ORF (AAH15317, 1 a.a. - 58 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00006767-P01.10ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16131052

  • 433.00 CHF / 10 Mikrogramm

Verfügbar ab: 08-07-2022
Sie sich ein, um den Lagerbestand zu sehen
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene. [provided by RefSeq]

Sequence: MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF
Spezifikation

Spezifikation

AAH15317
Liquid
6767
ST13 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF
RUO
ST13
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.12kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AAG2/FAM10A1/FAM10A4/FLJ27260/HIP/HOP/HSPABP/HSPABP1/MGC129952/P48/PRO0786/SNC6
ST13
Yes
wheat germ expression system
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote