Learn More
Abnova™ Human SELI Partial ORF (NP_277040, 1 a.a. - 50 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00085465-Q01.10ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq]
Sequence: MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAPSpezifikation
NP_277040 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.24kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAP | |
RUO | |
SELI | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
85465 | |
SELI (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
KIAA1724 | |
SELI | |
Recombinant | |
wheat germ expression system |