missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SELI Partial ORF (NP_277040, 1 a.a. - 50 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
361.00 CHF - 547.00 CHF
Spezifikation
| Zugriffsnummer | NP_277040 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 85465 |
| Molekulargewicht | 31.24kDa |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16151037
|
Abnova™
H00085465-Q01.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab: 31-05-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
|
16141037
|
Abnova™
H00085465-Q01.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab: 31-05-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Beschreibung
This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq]
Sequence: MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAPSpezifikation
| NP_277040 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.24kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| KIAA1724 | |
| SELI | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 85465 | |
| SELI (Human) Recombinant Protein (Q01) | |
| MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAP | |
| RUO | |
| SELI | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |