missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MYO7A Partial ORF (NP_000251, 2118 a.a. - 2213 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
361.00 CHF - 547.00 CHF
Spezifikation
| Zugriffsnummer | NP_000251 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 4647 |
| Molekulargewicht | 36.3kDa |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16131615
|
Abnova™
H00004647-Q01.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab: 06-06-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
|
16121615
|
Abnova™
H00004647-Q01.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab: 06-06-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Beschreibung
This gene is a member of the myosin gene family. Myosins are mechanochemical proteins characterized by the presence of a motor domain, an actin-binding domain, a neck domain that interacts with other proteins, and a tail domain that serves as an anchor. This gene encodes an unconventional myosin with a very short tail. Defects in this gene are associated with the mouse shaker-1 phenotype and the human Usher syndrome 1B which are characterized by deafness, reduced vestibular function, and (in human) retinal degeneration. Alternative splicing results in multiple transcript variants. [provided by RefSeq]
Sequence: KQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRSSpezifikation
| NP_000251 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.3kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DFNA11/DFNB2/MYOVIIA/MYU7A/NSRD2/USH1B | |
| MYO7A | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 4647 | |
| MYO7A (Human) Recombinant Protein (Q01) | |
| KQTTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRS | |
| RUO | |
| MYO7A | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |