missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MTMR1 Full-length ORF (AAH11250, 1 a.a. - 38 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00008776-P01.10ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq]
Sequence: MLSLPAPLRVNRGLWQLCTGAGLWLLQGALPVTRSWAVSpezifikation
| AAH11250 | |
| Liquid | |
| 8776 | |
| MTMR1 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MLSLPAPLRVNRGLWQLCTGAGLWLLQGALPVTRSWAV | |
| RUO | |
| MTMR1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 29.92kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MTMR1 | |
| Wheat Germ (in vitro) | |
| GST |