missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HSD3B7 Partial ORF (NP_079469, 101 a.a. - 209 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
361.00 CHF - 547.00 CHF
Spezifikation
| Zugriffsnummer | NP_079469 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 80270 |
| Molekulargewicht | 37.73kDa |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16130227
|
Abnova™
H00080270-Q01.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab:
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
|
16120227
|
Abnova™
H00080270-Q01.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab:
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Beschreibung
This gene encodes an enzyme which is involved in the initial stages of the synthesis of bile acids from cholesterol and a member of the short-chain dehydrogenase/reductase superfamily. The encoded protein is a membrane-associated endoplasmic reticulum protein which is active against 7-alpha hydrosylated sterol substrates. Mutations in this gene are associated with a congenital bile acid synthesis defect which leads to neonatal cholestasis, a form of progressive liver disease. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: IHEVNVQGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLVLEANGRKVRGGLPLVTCALRPTGIYGEGHQIMRDFYRQGSpezifikation
| NP_079469 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.73kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PFIC4/SDR11E3 | |
| HSD3B7 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 80270 | |
| HSD3B7 (Human) Recombinant Protein (Q01) | |
| IHEVNVQGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHRHPYPCSKALAEWLVLEANGRKVRGGLPLVTCALRPTGIYGEGHQIMRDFYRQG | |
| RUO | |
| HSD3B7 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |