missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HSD17B1 Partial ORF (NP_000404, 189 a.a. - 285 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00003292-Q01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
Sequence: VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFSpezifikation
| NP_000404 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.41kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF | |
| RUO | |
| HSD17B1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 3292 | |
| HSD17B1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| EDH17B2/EDHB17/HSD17/MGC138140/SDR28C1 | |
| HSD17B1 | |
| Recombinant | |
| wheat germ expression system |