Learn More
Abnova™ Human GRIPAP1 Partial ORF (NP_064522.3, 742 a.a. - 841 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00056850-Q01.10ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
GRASP1 is a neuron-specific guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF) and is associated with the GRIP/AMPA receptor complex in brain (Ye et al., 2000 [PubMed 10896157]).[supplied by OMIM]
Sequence: DLCRKSAIIETYVMDSRIDVSVAAGHTDRSGLGSVLRDLVKPGDENLREMNKKLQNMLEEQLTKNMHLHKDMEVLSQEIVRLSKECVGPPDPDLEPGETSSpezifikation
NP_064522.3 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
DLCRKSAIIETYVMDSRIDVSVAAGHTDRSGLGSVLRDLVKPGDENLREMNKKLQNMLEEQLTKNMHLHKDMEVLSQEIVRLSKECVGPPDPDLEPGETS | |
RUO | |
GRIPAP1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
56850 | |
GRIPAP1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DKFZp434P0630/GRASP-1/KIAA1167/MGC126593/MGC126595 | |
GRIPAP1 | |
Recombinant | |
wheat germ expression system |