Abnova™ Human GRIPAP1 Partial ORF (NP_064522.3, 742 a.a. - 841 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human GRIPAP1 Partial ORF (NP_064522.3, 742 a.a. - 841 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: p-7101379

Used for AP, Array, ELISA, WB-Re

361.00 CHF - 547.00 CHF

Spezifikation

Zugriffsnummer	NP_064522.3
Zur Verwendung mit (Anwendung)	Antibody Production, ELISA, Protein Array, Western Blot
Zusammensetzung	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez)	56850
Molekulargewicht	36.74kDa

Mehr Spezifikationen ansehen

Produkte 2

Produktcode	Marke	Menge	Preis	Menge & Verfügbarkeit
Produktcode	Marke	Menge	Preis	Menge & Verfügbarkeit
16138826 Unterlagen ansehen Aktionsdetails missing translation for 'viewProductCertificates'	Abnova™ H00056850-Q01.25UG	25 ug	547.00 CHF 25 Mikrogramm Alternative Produkte anzeigen Sparen Sie bis zu »	Verfügbar ab: 29-05-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen	Zum Warenkorb hinzufügen

16128826 Unterlagen ansehen Aktionsdetails missing translation for 'viewProductCertificates'	Abnova™ H00056850-Q01.10UG	10 ug	361.00 CHF 10 Mikrogramm Alternative Produkte anzeigen Sparen Sie bis zu »	Verfügbar ab: 29-05-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen	Zum Warenkorb hinzufügen

Beschreibung

GRASP1 is a neuron-specific guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF) and is associated with the GRIP/AMPA receptor complex in brain (Ye et al., 2000 [PubMed 10896157]).[supplied by OMIM]

Sequence: DLCRKSAIIETYVMDSRIDVSVAAGHTDRSGLGSVLRDLVKPGDENLREMNKKLQNMLEEQLTKNMHLHKDMEVLSQEIVRLSKECVGPPDPDLEPGETS

Spezifikation

Zugriffsnummer	NP_064522.3
Zusammensetzung	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molekulargewicht	36.74kDa
Qualitätskontrollen	12.5% SDS-PAGE Stained with Coomassie Blue.
Lagerungsbedingungen	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gen-Alias	DKFZp434P0630/GRASP-1/KIAA1167/MGC126593/MGC126595
Gensymbol	GRIPAP1
Rekombinant	Recombinant
Expressionssystem	wheat germ expression system

Zur Verwendung mit (Anwendung)	Antibody Production, ELISA, Protein Array, Western Blot
Gen-ID (Entrez)	56850
Name	GRIPAP1 (Human) Recombinant Protein (Q01)
Immunogen	DLCRKSAIIETYVMDSRIDVSVAAGHTDRSGLGSVLRDLVKPGDENLREMNKKLQNMLEEQLTKNMHLHKDMEVLSQEIVRLSKECVGPPDPDLEPGETS
Kennzeichnung	RUO
Gebräuchliche Bezeichnung	GRIPAP1
Spezies	Wheat Germ (in vitro)
Proteinmarkierung	GST
Form	Liquid

Zurück zum Seitenanfang

Abnova™ Human GRIPAP1 Partial ORF (NP_064522.3, 742 a.a. - 841 a.a.) Recombinant Protein with GST-tag at N-terminal

Spezifikation

Beschreibung

Spezifikation

Dokumentation