missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CD6 Partial ORF (NP_006716, 308 a.a. - 400 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
361.00 CHF - 547.00 CHF
Spécification
| Zugriffsnummer | NP_006716 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 923 |
| Molekulargewicht | 35.97kDa |
| Code produit | Marque | Menge | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Menge | Prix | Quantité et disponibilité | |||||
|
16135804
|
Abnova™
H00000923-Q01.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab: 07-06-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
|
16125804
|
Abnova™
H00000923-Q01.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab: 07-06-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Description
CD6 is a monomeric 105- or 130-kD membrane glycoprotein that is involved in T-cell activation. The size difference between the 2 CD6 forms is due to differences in phosphorylation (Robinson et al., 1995 [PubMed 7589069]).[supplied by OMIM]
Sequence: CGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMSpécification
| NP_006716 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.97kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ44171/TP120 | |
| CD6 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 923 | |
| CD6 (Human) Recombinant Protein (Q01) | |
| CGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM | |
| RUO | |
| CD6 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |