missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ HSBP1 (Human) Recombinant Protein
Human HSBP1 full-length ORF ( AAH07515, 1 a.a. - 76 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00003281-P01.25ug
Dettagli aggiuntivi : Gewicht : 0.00010kg
Descrizione
- Sequence: MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS
Specifica
| AAH07515 | |
| heat shock factor binding protein 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HSBP1 | |
| GST |
| 3281 | |
| Wheat germ expression system | |
| 25 μg | |
| DKFZp686D1664, DKFZp686O24200, NPC-A-13 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |