missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemische Reagenzien
  4. Peptide
  5. 18222415

Novus Biologicals™ HRCT1 Recombinant Protein Antigen

Code produit 18222415 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Menge:
100 μl
Conditionnement:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Menge Conditionnement
18222415 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18222415 Fournisseur Novus Biologicals™ Code fournisseur NBP257742PEP
 Eingeschränkter Artikel
Verfügbar ab: 27-11-2026
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HRCT1. Source: E.coli Amino Acid Sequence: QDCDVERNRTAAGGNRVRRAQPWPFRRRGHLGIFHHHR The HRCT1 Recombinant Protein Antigen is derived from E. coli. The HRCT1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spécification

Gene ID (Entrez) 646962
Reinigungsverfahren >80% by SDS-PAGE and Coomassie blue staining
Gebräuchliche Bezeichnung HRCT1 Recombinant Protein Antigen
Inhalt und Lagerung Store at −20°C. Avoid freeze-thaw cycles
Zusammensetzung PBS and 1M Urea, pH 7.4
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gen-Alias Histidine Rich Carboxyl Terminus 1, Histidine-Rich Carboxyl Terminus Protein 1, LGLL338, PRO537, UNQ338
Gensymbol HRCT1
Markertyp Unmarkiert
Produkttyp Recombinant Protein Antigen
Menge 100 μl
Kennzeichnung RUO
Quelle E. coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52988. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Afficher plus Afficher moins

Nur für Forschungszwecke.

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.