missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ HRCT1 Recombinant Protein Antigen
Alle ansehen Bio Techne Produkte
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HRCT1. Source: E.coli Amino Acid Sequence: QDCDVERNRTAAGGNRVRRAQPWPFRRRGHLGIFHHHR The HRCT1 Recombinant Protein Antigen is derived from E. coli. The HRCT1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Spezifikation
Spezifikation
| Gene ID (Entrez) | 646962 |
| Reinigungsverfahren | >80% by SDS-PAGE and Coomassie blue staining |
| Gebräuchliche Bezeichnung | HRCT1 Recombinant Protein Antigen |
| Inhalt und Lagerung | Store at −20°C. Avoid freeze-thaw cycles |
| Zusammensetzung | PBS and 1M Urea, pH 7.4 |
| Zur Verwendung mit (Anwendung) | Blocking/Neutralizing, Control |
| Gen-Alias | Histidine Rich Carboxyl Terminus 1, Histidine-Rich Carboxyl Terminus Protein 1, LGLL338, PRO537, UNQ338 |
| Gensymbol | HRCT1 |
| Markertyp | Unmarkiert |
| Produkttyp | Recombinant Protein Antigen |
| Mehr anzeigen |
Nur für Forschungszwecke.
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur