missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HIV-1 Gag p24 Antibody, Alexa Fluor™ 750, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-41214AF750
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
HIV-1 Gag p24 Polyclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA
Spezifikation
| HIV-1 Gag p24 | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla | |
| 0.1 mL | |
| Infections (Virus Bacteria and Parasites) | |
| 155030 | |
| Store at 4°C in the dark. | |
| IgG |
| Western Blot, ELISA | |
| Alexa Fluor 750 | |
| Rabbit | |
| Peptide affinity purified | |
| RUO | |
| Primary | |
| Virus | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur