missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 18147877

HIV-1 Gag p24 Antibody (7F4), HRP, Novus Biologicals™

Artikelnummer. 18147877 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mg
Packungsgröße:
0.10 Milligramm
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18147877 0.1 mg 0.10 Milligramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18147877 Lieferant Novus Biologicals Lieferanten-Nr. NBP241341

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse Monoclonal Antibody

HIV-1 Gag p24 Monoclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen HIV-1 Gag p24
Anwendungen Western Blot, ELISA
Klassifikation Monoclonal
Klon 7F4
Konzentration 1 mg/mL
Konjugat HRP
Verdünnung Western Blot 0.2 - 0.5 μg/mL, ELISA 0.2 - 0.5 μg/mL
Zusammensetzung Antibody is supplied in PBS containing 1% BSA and 0.02% thimerosol. with 0.02% Thimerosal
Gen-Alias Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24
Gensymbole gag
Wirtsspezies Mouse
Immunogen Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla
Molekulargewicht des Antigens 24, 41, 55 kDa
Reinigungsverfahren Affinity Purified
Menge 0.1 mg
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 155030
Testspezifität By Western blot, anti-HIV-1 Gag p24 antibody detects a ∼24 kDa, a ∼41 kDa, and a ∼55 kDa protein, corresponding to HIV-1 Gag p24 and to its precursors p41 and p55, respectively, in HIV-1 samples.
Zielspezies Virus
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG1
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.